PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009788P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 505aa    MW: 54329.6 Da    PI: 6.3692
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009788P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.6e-38113172261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+++cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grr+nk+ 
  MELO3C009788P1 113 PDKIIPCPRCNSLETKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPIGAGRRRNKQL 172
                     7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-30110170IPR003851Zinc finger, Dof-type
PfamPF027014.4E-31115171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.463117171IPR003851Zinc finger, Dof-type
PROSITE patternPS013610119155IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MTSSTTTQDV ISPPHFKDLA IKLFGRTIPL PESQISAAPL HNPDACNNLK KAEQSVSGAE  60
DSCPSERSSV LVGDNEENQA SNVMSNKGES ELHLKEEQAD GNGTDQERAF KKPDKIIPCP  120
RCNSLETKFC YFNNYNVNQP RHFCKNCQRY WTAGGTMRNV PIGAGRRRNK QLASQYRQII  180
VSSEGVATAR LETSDATNHH HLLSSVESPP ALRPSNGSST VLKFGPEAPL CESMETVLSL  240
GDQKRSIEIG SAYCGDSPEE PSSCGSSMTT TSIRGNELSK SVIERPEAVR LSNSSSDITA  300
SNTVHCYPVP QLVFPLNQGG SSLISSAMTQ SSDSTSVPNI SSHPNPPVQW LPATMLAVPG  360
FCTPSLPLQF VPASCWGCTP VWTSTGTGNL TVVPSDVCAS QTSTCPTSSS PTLGKHLRDT  420
NSLAEDEKSE KCVVVPKTLR VDNPSEASRS PIWTTFGIHP YPKENISKGS VFETSETTNA  480
DSKGHFRDTP QILEAKTGSF YSLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443297.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLA0A0A0LBU40.0A0A0A0LBU4_CUCSA; Uncharacterized protein
STRINGPOPTR_0019s05720.11e-159(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-58cycling DOF factor 2